POMZP3 Antibody
| Name | POMZP3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13788 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: MVCSPVTLRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSA LKEKKKK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | POMZP3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | POMZP3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: POMZP3 Antibody [NBP2-13788] - Staining of human cell line A-431 shows localization to nucleoplasm & nuclear membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9927_POMZP3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13788-img0002.jpg)
Immunocytochemistry/Immunofluorescence: POMZP3 Antibody [NBP2-13788] - Staining of human cell line A-431 shows localization to nucleoplasm & nuclear membrane.
![Immunohistochemistry-Paraffin: POMZP3 Antibody [NBP2-13788] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9928_POMZP3-Antibody-Immunohistochemistry-Paraffin-NBP2-13788-img0001.jpg)
Immunohistochemistry-Paraffin: POMZP3 Antibody [NBP2-13788] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.