PNMA3 Antibody

Name PNMA3 Antibody
Supplier Novus Biologicals
Catalog NBP2-13782
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: PRPPARITGVGAVPLPASGNSFDVRPSQGYRRRRGRGQHRRGGVARAGSR GSRKRKRHTFCYSCG
Purity/Format Immunogen affinity purified
Blocking Peptide PNMA3 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene PNMA3
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.