Plasmolipin Antibody
| Name | Plasmolipin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-13777 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAEFPSKVSTRTSSPAQGAEASVSALRPDLGFVRS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Plasmolipin Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PLLP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: Plasmolipin Antibody [NBP2-13777] - Staining of human stomach shows strong membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19418_Plasmolipin-Antibody-Immunohistochemistry-NBP2-13777-img0002.jpg)
Immunohistochemistry: Plasmolipin Antibody [NBP2-13777] - Staining of human stomach shows strong membranous positivity in glandular cells.