FAM43B Antibody

Name FAM43B Antibody
Supplier Novus Biologicals
Catalog NBP2-14709
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: PWRRNKFVLVEDEAKCKAKSLSPGLAYTSLLSSFLRSCPDLLPDWPLERL GRVFRSRRQKVELNKEDPTYTVWY
Purity/Format Immunogen affinity purified
Blocking Peptide FAM43B Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene FAM43B
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.