FBXO48 Antibody
| Name | FBXO48 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14691 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: SKRNNNLRVSHTEANSVDAEKEKNESQNNFFELLPAEITFKIFSQLDIRS LCRASL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FBXO48 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FBXO48 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: FBXO48 Antibody [NBP2-14691] - Staining of human cell line U-2 OS shows localization to nuclear bodies.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10902_FBXO48-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14691-img0003.jpg)
Immunocytochemistry/Immunofluorescence: FBXO48 Antibody [NBP2-14691] - Staining of human cell line U-2 OS shows localization to nuclear bodies.
![Immunohistochemistry-Paraffin: FBXO48 Antibody [NBP2-14691] - Staining of human stomach, upper shows strong cytoplasmic positivity in superficial glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10903_FBXO48-Antibody-Immunohistochemistry-Paraffin-NBP2-14691-img0002.jpg)
Immunohistochemistry-Paraffin: FBXO48 Antibody [NBP2-14691] - Staining of human stomach, upper shows strong cytoplasmic positivity in superficial glandular cells.