C18orf42 Antibody

Name C18orf42 Antibody
Supplier Novus Biologicals
Catalog NBP2-14679
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: FWLGEKPGNEPEEVKLQNASKQIVQNAILQAVQQVSQESQRREERISDNR DHIQLGVGELTKKHEKK
Purity/Format Immunogen affinity purified
Blocking Peptide C18orf42 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene C18orf42
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.