FAM69C Antibody
| Name | FAM69C Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14666 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: LSFLDMVNHFDSDFSHRLHLCDIKPENFAIRSDFTVVAIDVDMAFFEPKM REILEQNCTGDEDCNFFDCF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM69C Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FAM69C |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: FAM69C Antibody [NBP2-14666] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/2919_FAM69C-Antibody-Immunohistochemistry-Paraffin-NBP2-14666-img0002.jpg)
Immunohistochemistry-Paraffin: FAM69C Antibody [NBP2-14666] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.