CCDC109B Antibody

Name CCDC109B Antibody
Supplier Novus Biologicals
Catalog NBP2-14657
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids: SNEHTAEMEHMKSLVHRLFTILHLEESQKKREHHLLEKIDHLKEQLQPLE QVKAGIEAHSE
Purity/Format Immunogen affinity purified
Blocking Peptide CCDC109B Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene CCDC109B
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.