SELH Antibody
| Name | SELH Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-14637 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids: KVNPTKPRRGSFEVTLLRPDGSSAELWTGIKKGPPRKLKFPEPQEVVEEL KKYLS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SELH Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | C11orf31 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SELH Antibody [NBP2-14637] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10884_SELH%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14637-img0004.jpg)
Immunocytochemistry/Immunofluorescence: SELH Antibody [NBP2-14637] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
![Immunohistochemistry-Paraffin: SELH Antibody [NBP2-14637] - Staining of human bronchus shows strong nuclear positivity in respiratory epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10885_SELH-Antibody-Immunohistochemistry-Paraffin-NBP2-14637-img0002.jpg)
Immunohistochemistry-Paraffin: SELH Antibody [NBP2-14637] - Staining of human bronchus shows strong nuclear positivity in respiratory epithelial cells.