FIBCD1 Antibody
| Name | FIBCD1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31570 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LIQLLSESQGHMAHLVNSVSDILDALQRDRGLGRPRNKADLQRAPARGTRPRGCATGSRPRDCLDVLLSGQQDDGVYSVFPTHYP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FIBCD1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FIBCD1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: FIBCD1 Antibody [NBP2-31570] - Immunohistochemical staining of human colon shows moderate nuclear and cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25599_FIBCD1-Antibody-Immunohistochemistry-NBP2-31570-img0004.jpg)
Immunohistochemistry: FIBCD1 Antibody [NBP2-31570] - Immunohistochemical staining of human colon shows moderate nuclear and cytoplasmic positivity in glandular cells.