CCDC42 Antibody
| Name | CCDC42 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91217 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LGIMEEEDLAEYFRLQYGERLLQMLQKLPNVEGASESPSIWLLEKKKETEIMHQTMVQKKKMFQRRMETLNLRWEELGVKEAQLK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CCDC42 Protein |
| Description | Rabbit Polyclonal |
| Gene | CCDC42 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: CCDC42 Antibody [NBP1-91217] - Staining of human kidney shows strong cytoplasmic and membranous positivity in tubular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25605_CCDC42-Antibody-Immunohistochemistry-NBP1-91217-img0002.jpg)
Immunohistochemistry: CCDC42 Antibody [NBP1-91217] - Staining of human kidney shows strong cytoplasmic and membranous positivity in tubular cells.