DSPG3/EPYC Antibody

Name DSPG3/EPYC Antibody
Supplier Novus Biologicals
Catalog NBP2-33445
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: PTLESINYDSETYDATLEDLDNLYNYENIPVDKVEIEIATVMPSGNRELLTPPPQPEKAQEEEEE
Purity/Format Immunogen affinity purified
Blocking Peptide DSPG3/EPYC Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene EPYC
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.