ANKRD7 Antibody
| Name | ANKRD7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91671 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RTALILAVSGEPPCLVKLLLQQGVELCYEGIVDSQLRNMFISMVLLHRYPQFTASHGKKKHA |
| Description | Rabbit Polyclonal |
| Gene | ANKRD7 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: ANKRD7 Antibody [NBP1-91671] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25644_ANKRD7-Antibody-Immunohistochemistry-Paraffin-NBP1-91671-img0003.jpg)
Immunohistochemistry-Paraffin: ANKRD7 Antibody [NBP1-91671] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.