BEX4 Antibody
| Name | BEX4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91702 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:WAIPNRHIEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | BEX4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | BEX4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: BEX4 Antibody [NBP1-91702] Staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells along with distinct extracellular positivity..](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/971_BEX4%2520Antibody-Immunohistochemistry-Paraffin-NBP1-91702-img0002.jpg)
Immunohistochemistry-Paraffin: BEX4 Antibody [NBP1-91702] Staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells along with distinct extracellular positivity..