CCDC19 Antibody
| Name | CCDC19 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91757 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:VDESLFGDIKSPAQGQSDSPIVLLRDKHTLQKTLTALGLDRKPETIQLITRDMVRELIVPTEDPSGESLIISPEEFERIKWAS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CCDC19 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CFAP45 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: CCDC19 Antibody [NBP1-91757] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6966_CCDC19%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91757-img0005.jpg)
Immunocytochemistry/Immunofluorescence: CCDC19 Antibody [NBP1-91757] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
![Immunohistochemistry: CCDC19 Antibody [NBP1-91757] - Staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6967_CCDC19-Antibody-Immunohistochemistry-NBP1-91757-img0003.jpg)
Immunohistochemistry: CCDC19 Antibody [NBP1-91757] - Staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.