Gonadotropin Inducible Transcription Repressor 1 Antibody
| Name | Gonadotropin Inducible Transcription Repressor 1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91956 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NNFLDNNEATDINADLASRDEPQKLSPKRDIYETELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Gonadotropin Inducible Transcription Repressor 1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZNF461 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Gonadotropin Inducible Transcription Repressor 1 Antibody [NBP1-91956] - Staining of human cell line U-2 OS shows localization to nucleus, nucleoli & the Golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11223_Gonadotropin-Inducible-Transcription-Repressor-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91956-img0003.jpg)
Immunocytochemistry/Immunofluorescence: Gonadotropin Inducible Transcription Repressor 1 Antibody [NBP1-91956] - Staining of human cell line U-2 OS shows localization to nucleus, nucleoli & the Golgi apparatus.
![Immunohistochemistry: Gonadotropin Inducible Transcription Repressor 1 Antibody [NBP1-91956] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11224_Gonadotropin-Inducible-Transcription-Repressor-1-Antibody-Immunohistochemistry-NBP1-91956-img0002.jpg)
Immunohistochemistry: Gonadotropin Inducible Transcription Repressor 1 Antibody [NBP1-91956] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.