NIPSNAP3B Antibody
| Name | NIPSNAP3B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33509 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LTKALASRTLAPQVCSSFATGPRQYDGTFYEFR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NIPSNAP3B Protein |
| Description | Rabbit Polyclonal |
| Gene | NIPSNAP3B |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: NIPSNAP3B Antibody [NBP2-33509] - Immunohistochemical staining of human epididymis shows strong membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25798_NIPSNAP3B%2520Antibody-Immunohistochemistry-Paraffin-NBP2-33509-img0001.jpg)
Immunohistochemistry-Paraffin: NIPSNAP3B Antibody [NBP2-33509] - Immunohistochemical staining of human epididymis shows strong membranous positivity in glandular cells.