SLC5A5/Sodium Iodide Symporter Antibody
| Name | SLC5A5/Sodium Iodide Symporter Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33547 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SLC5A5/Sodium Iodide Symporter Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLC5A5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: Sodium Iodide Symporter Antibody [NBP2-33547] - Staining of human salivary gland shows membranous positivity in ductal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/3584_Sodium%2520Iodide%2520Symporter%2520Antibody-Immunohistochemistry-Paraffin-NBP2-33547-img0001.jpg)
Immunohistochemistry-Paraffin: Sodium Iodide Symporter Antibody [NBP2-33547] - Staining of human salivary gland shows membranous positivity in ductal cells.