DARPP-32 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-33534
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: PTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDE
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: DARPP-32 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: PPP1R1B
• Conjugate: Unconjugated

Product images

Western Blot: DARPP-32 Antibody [NBP2-33534] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue

Immunocytochemistry/Immunofluorescence: DARPP-32 Antibody [NBP2-33534] - Staining of mouse olfactory bulb shows immunoreactivity in a subset of neurons.

Immunohistochemistry-Paraffin: DARPP-32 Antibody [NBP2-33534] - Staining of human cerebellum shows positivity in Purkinje cells and cells in molecular layer.

Immunocytochemistry/Immunofluorescence: DARPP-32 Antibody [NBP2-33534] - Staining of mouse cerebellum shows positivity in all the layers.

Immunocytochemistry/Immunofluorescence: DARPP-32 Antibody [NBP2-33534] - Staining of mouse hippocampus shows positivity in neurons.

Immunocytochemistry/Immunofluorescence: DARPP-32 Antibody [NBP2-33534] - Staining of mouse motor trigeminal nucleus shows immunoreactivity in neuronal cell bodies.

Immunocytochemistry/Immunofluorescence: DARPP-32 Antibody [NBP2-33534] - Staining of mouse visual cortex shows neuronal immunoreactivity.

Immunohistochemistry-Paraffin: DARPP-32 Antibody [NBP2-33534] - Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules.

Immunohistochemistry-Paraffin: DARPP-32 Antibody [NBP2-33534] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.