BCL2L15 Antibody
| Name | BCL2L15 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90768 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:CIVNTLLMDFLSPTLQVASRNLCCVDEVDSGEPCSFDVAIIAGRLRMLGDQFNGELEASAKNVIAETIKG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | BCL2L15 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | BCL2L15 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: BCL2L15 Antibody [NBP1-90768] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25816_BCL2L15-Antibody-Immunohistochemistry-NBP1-90768-img0003.jpg)
Immunohistochemistry: BCL2L15 Antibody [NBP1-90768] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.