BRI3BP Antibody
| Name | BRI3BP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88564 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSSSPARALLLVGVV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | BRI3BP Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | BRI3BP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: BRI3BP Antibody [NBP1-88564] - Staining of human cell line RT4 shows localization to nucleoplasm & mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5951_BRI3BP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88564-img0004.jpg)
![Immunohistochemistry: BRI3BP Antibody [NBP1-88564] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5952_BRI3BP-Antibody-Immunohistochemistry-NBP1-88564-img0003.jpg)