Cytochrome P450 2C8 Antibody
| Name | Cytochrome P450 2C8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88055 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Cytochrome P450 2C8 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CYP2C8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: Cytochrome P450 2C8 Antibody [NBP1-88055] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/456_Cytochrome-P450-2C8-Antibody-Immunohistochemistry-NBP1-88055-img0003.jpg)
Immunohistochemistry: Cytochrome P450 2C8 Antibody [NBP1-88055] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.