ACOT11 Antibody
| Name | ACOT11 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88647 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LCSGFCLWREGDQLTKCCWVRVSLTELVSASGFYSWGLESRSKGRRSDGWNGKLAGGHLSTLKAIPVAKINS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ACOT11 Protein |
| Description | Rabbit Polyclonal |
| Gene | ACOT11 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: ACOT11 Antibody [NBP1-88647] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/25977_ACOT11-Antibody-Immunohistochemistry-NBP1-88647-img0003.jpg)
Immunohistochemistry: ACOT11 Antibody [NBP1-88647] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.