GPR62 Antibody
| Name | GPR62 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87522 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PVRLALGRLSRRALPGPVRACTPQAWHPRALLQCLQRPPEGPAVGPSEAPEQTPELAGGRSPAYQGPPESSL |
| Description | Rabbit Polyclonal |
| Gene | GPR62 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: GPR62 Antibody [NBP1-87522] - Staining of human testis shows strong cytoplasmic positivity in subsets of cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/26006_GPR62-Antibody-Immunohistochemistry-NBP1-87522-img0003.jpg)
Immunohistochemistry: GPR62 Antibody [NBP1-87522] - Staining of human testis shows strong cytoplasmic positivity in subsets of cells in seminiferus ducts.