PEPP3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-87889
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:SIHEVDISNLEAALRAEEPGGHAYETPREEIARLRKMELEPQHYDVDINKELSTPDKVLIPERYIDLEPDTPLSPEELKEKQ
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: PEPP3 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: PLEKHA6
• Conjugate: Unconjugated

Product images

Immunocytochemistry/Immunofluorescence: PEPP3 Antibody [NBP1-87889] - Staining of human cell line RT4 shows localization to cell junctions.

Immunohistochemistry-Paraffin: PEPP3 Antibody [NBP1-87889] - Staining of human stomach shows strong membranous and cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PEPP3 Antibody [NBP1-87889] - Staining of human stomach shows strong membranous and cytoplasmic positivity in glandular cells.