OAF Antibody

Name OAF Antibody
Supplier Novus Biologicals
Catalog NBP1-93464
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:RFWLEQGVDSSVFEALPKASEQAELPRCRQVGDRGKPCVCHYGLSLAWYPCMLKYCHSRDRPTPYKCGIRSCQKSYSFDFYVPQ
Purity/Format Immunogen affinity purified
Blocking Peptide OAF Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene OAF
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.