C9orf153 Antibody
| Name | C9orf153 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-94130 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LTGDTSPAEDNREATLPQCSLPELYACIENFNKESKKSNLLKMHGISLNEAQEVLARNLNVMSFTRGADVRGDLQPVIS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C9orf153 Protein |
| Description | Rabbit Polyclonal |
| Gene | C9orf153 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: C9orf153 Antibody [NBP1-94130] Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/26110_C9orf153%2520Antibody-Immunohistochemistry-Paraffin-NBP1-94130-img0002.jpg)
Immunohistochemistry-Paraffin: C9orf153 Antibody [NBP1-94130] Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.