Cyclin I Antibody
| Name | Cyclin I Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-34060 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: VYRPLKHTLVTCDKGVFRLHPSSVPGPDFSKDNSKPEVPVRGTAAFYHHLPAASGCKQTSTKRKVEEMEVDDFYDGIKRLYNEDNV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Cyclin I Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CCNI |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Cyclin I Antibody [NBP2-34060] - Staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9000_Cyclin-I-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-34060-img0004.jpg)
Immunocytochemistry/Immunofluorescence: Cyclin I Antibody [NBP2-34060] - Staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear bodies & cytosol.
![Immunohistochemistry: Cyclin I Antibody [NBP2-34060] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9001_Cyclin-I-Antibody-Immunohistochemistry-NBP2-34060-img0002.jpg)
Immunohistochemistry: Cyclin I Antibody [NBP2-34060] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferus ducts.