Adenosine A3 R Antibody
| Name | Adenosine A3 R Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90247 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KKFKETYLLILKACVVCHPSDSLDTSIEKNS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Adenosine A3 R Protein |
| Description | Rabbit Polyclonal |
| Gene | ADORA3 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: Adenosine A3 R Antibody [NBP1-90247] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/26172_Adenosine-A3-R-Antibody-Immunohistochemistry-NBP1-90247-img0003.jpg)
Immunohistochemistry: Adenosine A3 R Antibody [NBP1-90247] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.