RNF208 Antibody
| Name | RNF208 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90502 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:EGAPHTPPLPRRPRKGSSELGFPRVAPEDEVIVNQYVIRPGPSASAASSAAAGEPLECPTCGHSYNVTQRRPRVLSCLHSVCEQC |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RNF208 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RNF208 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: RNF208 Antibody [NBP1-90502] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26288_RNF208%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90502-img0004.jpg)
![Immunohistochemistry: RNF208 Antibody [NBP1-90502] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26289_RNF208-Antibody-Immunohistochemistry-NBP1-90502-img0002.jpg)