ANKRD13C Antibody
| Name | ANKRD13C Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90568 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:IRLDTTLIDFTDMKCQRGDLSFIFNGDAAPSESFVVLDNEQKVYQRIHHEESEMETEEEVDILMSSDIYSATLSTKSISFT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ANKRD13C Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ANKRD13C |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: ANKRD13C Antibody [NBP1-90568] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/132_ANKRD13C-Antibody-Immunohistochemistry-NBP1-90568-img0004.jpg)
Immunohistochemistry: ANKRD13C Antibody [NBP1-90568] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.