serine protease 55 Antibody
| Name | serine protease 55 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90650 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:YSEELFPEELSVVLGTNDLTSPSMEIKEVASIILHKDFKRANMDNDIALLLLASPIKLDDLKVP |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PRSS55 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: serine protease 55 Antibody [NBP1-90650] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/26246_serine-protease-55-Antibody-Immunohistochemistry-NBP1-90650-img0003.jpg)
Immunohistochemistry: serine protease 55 Antibody [NBP1-90650] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.