DHRS7C Antibody
| Name | DHRS7C Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90667 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:HTGGARLVLCGKNWERLENLYDALISVADPSKTFTPKLVLLDLSDISCVPDVAKEVLDCYGCVDILINNASVKVKG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DHRS7C Protein |
| Description | Rabbit Polyclonal |
| Gene | DHRS7C |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: DHRS7C Antibody [NBP1-90667] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus duct cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/26259_DHRS7C-Antibody-Immunohistochemistry-NBP1-90667-img0003.jpg)
Immunohistochemistry: DHRS7C Antibody [NBP1-90667] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus duct cells.