DNAJC19 Antibody
| Name | DNAJC19 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87346 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DNAJC19 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DNAJC19 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: DNAJC19 Antibody [NBP1-87346] - Staining of human kidney shows strong cytoplasmic and extracellular positivity in tubule cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/6995_DNAJC19-Antibody-Immunohistochemistry-NBP1-87346-img0003.jpg)
Immunohistochemistry: DNAJC19 Antibody [NBP1-87346] - Staining of human kidney shows strong cytoplasmic and extracellular positivity in tubule cells.