RP9 Antibody
| Name | RP9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87342 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PEQELQRRREQKRRRHDAQQLQQLKHLESFYEKPPPGLIKEDETKPEDCIPDVPGNEHAREFLAHAPTKGLWM |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RP9 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RP9 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: RP9 Antibody [NBP1-87342] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/26288_RP9-Antibody-Immunohistochemistry-NBP1-87342-img0003.jpg)
Immunohistochemistry: RP9 Antibody [NBP1-87342] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.