Keratin 36 Antibody
| Name | Keratin 36 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87838 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:TCTPTFSTGSIKGLCGTAGGISRVSSIRSVGSCRVPSLAGAAGYISSARSGLSGLGSCLPGSYLSSECHTSGFVGSGGWFCEGSFNGSEKE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Keratin 36 Protein |
| Description | Rabbit Polyclonal |
| Gene | KRT36 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: Keratin 36 Antibody [NBP1-87838] Staining of human spleen shows strong positivity in subsets of cells outside the reaction center.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/26302_Keratin%252036%2520Antibody-Immunohistochemistry-Paraffin-NBP1-87838-img0002.jpg)
Immunohistochemistry-Paraffin: Keratin 36 Antibody [NBP1-87838] Staining of human spleen shows strong positivity in subsets of cells outside the reaction center.