GIN-1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-89856
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:NGDLHLKQIAYYKRTGEYHSTTLPSERSGIRRAAKKFVFKEKKLFYVGKDRKQNRLVIVSEEEKKKVLRECHENDSGAHHGISRTLT
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: GIN-1 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: GIN1
• Conjugate: Unconjugated

Product images

Immunohistochemistry: GIN-1 Antibody [NBP1-89856] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.