Ly-6G6C Antibody
| Name | Ly-6G6C Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92087 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PVLGCVDRQSCRLEPGQQCLTTHAYLGKMWVFSNLRCGTPEEPCQEAFNQTNRKLGLTYNTTCCNKDNCNSAG |
| Purity/Format | Affinity purified |
| Description | Rabbit Polyclonal |
| Gene | LY6G6C |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: Ly-6G6C Antibody [NBP1-92087] - Staining of human cerebral cortex shows distinct cytoplasmic positivity in a subset of glial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/4448_Ly-6G6C-Antibody-Immunohistochemistry-Paraffin-NBP1-92087-img0003.jpg)
Immunohistochemistry-Paraffin: Ly-6G6C Antibody [NBP1-92087] - Staining of human cerebral cortex shows distinct cytoplasmic positivity in a subset of glial cells.