LRRC44 Antibody
| Name | LRRC44 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92079 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:QRAGMKLRTFSDIDKYYTEQKKQEYHKEKVRVVAMAQVARERVRVAVNEHLNQKKYATQKLIEENKETIQNSLRQVWQNRFNYL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LRRC44 Protein |
| Description | Rabbit Polyclonal |
| Gene | LRRIQ3 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: LRRC44 Antibody [NBP1-92079] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/26466_LRRC44-Antibody-Immunohistochemistry-NBP1-92079-img0002.jpg)
Immunohistochemistry: LRRC44 Antibody [NBP1-92079] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.