NOL4 Antibody
| Name | NOL4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92193 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KYERIVQLLNGSESSSTDNAKFKFWVKSKGFQLGQPDEVRGGGGGAKQVLYVPVKTTDGVGVDEKLSLRR |
| Description | Rabbit Polyclonal |
| Gene | NOL4 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: NOL4 Antibody [NBP1-92193] - Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/26474_NOL4%2520Antibody-Immunohistochemistry-Paraffin-NBP1-92193-img0001.jpg)
Immunohistochemistry-Paraffin: NOL4 Antibody [NBP1-92193] - Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.