ZMIZ1/Zimp10 Antibody
| Name | ZMIZ1/Zimp10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92610 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MNSMDRHIQQTNDRLQCIKQHLQNPANFHNAATELLDWCGDPRAFQRPFEQSLMGCLTVVSRVAAQQGFDLDLGYRLLAVCAANRDKFT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZMIZ1/Zimp10 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ZMIZ1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ZMIZ1/Zimp10 Antibody [NBP1-92610] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26258_ZMIZ1-Zimp10%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92610-img0005.jpg)
Immunocytochemistry/Immunofluorescence: ZMIZ1/Zimp10 Antibody [NBP1-92610] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & vesicles.
![Immunohistochemistry-Paraffin: ZMIZ1/Zimp10 Antibody [NBP1-92610] - Staining of human gallbladder shows cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26259_ZMIZ1-Zimp10-Antibody-Immunohistochemistry-Paraffin-NBP1-92610-img0004.jpg)
Immunohistochemistry-Paraffin: ZMIZ1/Zimp10 Antibody [NBP1-92610] - Staining of human gallbladder shows cytoplasmic positivity in glandular cells.