TGIF2LY Antibody
| Name | TGIF2LY Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92493 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:VPAKSGPVVQTMYKACPCGPCQRARCQERSNQIRSRPLARSSPE |
| Description | Rabbit Polyclonal |
| Gene | TGIF2LY |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: TGIF2LY Antibody [NBP1-92493] Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/26567_TGIF2LY%2520Antibody-Immunohistochemistry-Paraffin-NBP1-92493-img0002.jpg)
Immunohistochemistry-Paraffin: TGIF2LY Antibody [NBP1-92493] Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.