C15orf62 Antibody

Name C15orf62 Antibody
Supplier Novus Biologicals
Catalog NBP1-93538
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:SLSSALHQHSEKGLVDTPCFQRTPTPDLSDPFLSFKVDLGISLLEEVLQMLREQFPSEPSF
Purity/Format Immunogen affinity purified
Blocking Peptide C15orf62 Protein
Description Rabbit Polyclonal
Gene C15orf62
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.