SPINK4 Antibody
| Name | SPINK4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-93519 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LPFSRMPICEHMVESPTCSQMSNLVCGTDGLTYTNECQLCLARIKTKQDIQIMKDGK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SPINK4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SPINK4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SPINK4 Antibody [NBP1-93519] - Immunofluorescent staining of human cell line HeLa shows localization to nucleus, the Golgi apparatus & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8391_SPINK4%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-93519-img0005.jpg)
Immunocytochemistry/Immunofluorescence: SPINK4 Antibody [NBP1-93519] - Immunofluorescent staining of human cell line HeLa shows localization to nucleus, the Golgi apparatus & vesicles.
![Immunohistochemistry: SPINK4 Antibody [NBP1-93519] - Staining of human colon shows strong cytoplasmic positivity in goblet cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8392_SPINK4-Antibody-Immunohistochemistry-NBP1-93519-img0003.jpg)
Immunohistochemistry: SPINK4 Antibody [NBP1-93519] - Staining of human colon shows strong cytoplasmic positivity in goblet cells.