VPS37D Antibody
| Name | VPS37D Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-93480 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LRDLLQDEPKLDRIVRLSRKFQGLQLEREACLASNYALAKENLALRPRLEMGRAALAIKYQELREVAENCADKLQRLEESMHRWSPHC |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | VPS37D Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | VPS37D |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: VPS37D Antibody [NBP1-93480] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9125_VPS37D%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-93480-img0005.jpg)
![Immunohistochemistry: VPS37D Antibody [NBP1-93480] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9126_VPS37D-Antibody-Immunohistochemistry-NBP1-93480-img0003.jpg)