KRT73 Antibody
| Name | KRT73 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-93670 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:VINSSMAGMAGTGAGFGFSNAGTYGYWPSSVSGGYSMLPGGCVTGSGNCSPRGEARTRLGSASEFRDSQGKTLA |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | KRT73 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: KRT73 Antibody [NBP1-93670] - Immunohistochemical staining of human stomach shows moderate cytoplasmic and occasional nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/26653_KRT73-Antibody-Immunohistochemistry-Paraffin-NBP1-93670-img0002.jpg)
Immunohistochemistry-Paraffin: KRT73 Antibody [NBP1-93670] - Immunohistochemical staining of human stomach shows moderate cytoplasmic and occasional nuclear positivity in glandular cells.