Fucose Mutarotase Antibody
| Name | Fucose Mutarotase Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-93896 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MVALKGVPALLSPELLYALARMGHGDEIVLADLNFPASSICQCGPMEIRADGLGIPQLLEAVL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Fucose Mutarotase Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FUOM |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: Fucose Mutarotase Antibody [NBP1-93896] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/3999_Fucose%2520Mutarotase%2520Antibody-Immunohistochemistry-Paraffin-NBP1-93896-img0005.jpg)
Immunohistochemistry-Paraffin: Fucose Mutarotase Antibody [NBP1-93896] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.