C19orf12 Antibody

Name C19orf12 Antibody
Supplier Novus Biologicals
Catalog NBP1-94063
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:GAWMTSGQFKPVPQILMELPPAEQQRLFNEAAAIIRHLEWTDAVQLTALVMGSEALQQQLLAMLVNYVTKELRAEIQ
Purity/Format Immunogen affinity purified
Blocking Peptide C19orf12 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene C19orf12
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.