SUV420H2 Antibody
| Name | SUV420H2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30524 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: EGFFGEKNEHCECHTCERKGEGAFRTRPREPALPPRPLDKYQLRETKRRLQQGLDSG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SUV420H2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SUV420H2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SUV420H2 Antibody [NBP2-30524] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26757_SUV420H2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30524-img0003.jpg)
Immunocytochemistry/Immunofluorescence: SUV420H2 Antibody [NBP2-30524] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
![Immunohistochemistry: SUV420H2 Antibody [NBP2-30524] - Staining of human hippocampus shows strong cytoplasmic and nuclear positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26758_SUV420H2-Antibody-Immunohistochemistry-NBP2-30524-img0001.jpg)
Immunohistochemistry: SUV420H2 Antibody [NBP2-30524] - Staining of human hippocampus shows strong cytoplasmic and nuclear positivity in neuronal cells.