RAB30 Antibody
| Name | RAB30 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30410 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: RSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RAB30 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RAB30 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: RAB30 Antibody [NBP2-30410] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8211_RAB30%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30410-img0003.jpg)
![Immunohistochemistry: RAB30 Antibody [NBP2-30410] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8212_RAB30-Antibody-Immunohistochemistry-NBP2-30410-img0001.jpg)